Iright
BRAND / VENDOR: Proteintech

Proteintech, 30461-1-AP, CDK13 Polyclonal antibody

CATALOG NUMBER: 30461-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CDK13 (30461-1-AP) by Proteintech is a Polyclonal antibody targeting CDK13 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 30461-1-AP targets CDK13 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells, MDA-MB-468 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Cyclin-dependent kinase 13 (CDK13) is also named as CDC2L, CDC2L5, CHED and KIAA1791, and belongs to the CMGC Ser/Thr protein kinase family. Interestingly, in TNBC cells silencing CDK13 provokes cell death without affecting DDR genes. Like CDK12, CDK13 phosphorylates the Ser2 position of the heptad repeat in the CTD of RNA Pol II (PMID:26748711). CDK13/CycK complex is that regulates transcription by phosphorylating serine residues at positions 5 and 2 of the heptapeptide repeats (Y-S-P-T-S-P-S) comprising the C-terminal domain (CTD) of RPB1, the largest subunit of RNA polymerase II (RNAPII). CDK13 is expressed in fetal brain, liver, and muscle, and adult whole brain, hippocampus, and bone marrow (PMID:30904094). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32897 Product name: Recombinant human CDK13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1150-1300 aa of NM_003718.4 Sequence: QESSKPLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDVLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQRPPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKA Predict reactive species Full Name: cell division cycle 2-like 5 (cholinesterase-related cell division controller) Calculated Molecular Weight: 165 kDa Observed Molecular Weight: 170 kDa GenBank Accession Number: NM_003718.4 Gene Symbol: CDK13 Gene ID (NCBI): 8621 RRID: AB_3086325 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14004 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924