Iright
BRAND / VENDOR: Proteintech

Proteintech, 30474-1-AP, TOX2 Polyclonal antibody

CATALOG NUMBER: 30474-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TOX2 (30474-1-AP) by Proteintech is a Polyclonal antibody targeting TOX2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 30474-1-AP targets TOX2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, mouse liver tissue, rat liver tissue Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TOX2 is a transcription factor belonging to the TOX (thymocyte selection-associated HMG box) family that shares a highly conserved high mobility group DNA-binding domain with the other TOX members. A previous study showed that TOX2 is preferentially expressed in human NK cells among various leukocyte populations and is required for in vitro and in vivo human NK cell differentiation from UCB-derived CD341 hematopoietic stem cells (HSCs) (PMID: 25352127). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31226 Product name: Recombinant human TOX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 303-424 aa of BC007636 Sequence: SSPDQGETKSTQANPPAKMLPPKQPMYAMPGLASFLTPSDLQAFRSGASPASLARTLGSKSLLPGLSASPPPPPSFPLSPTLHQQLSLPPHAQGALLSPPVSMSPAPQPPVLPTPMALQVQL Predict reactive species Full Name: TOX high mobility group box family member 2 Calculated Molecular Weight: 488 aa, 52 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC007636 Gene Symbol: TOX2 Gene ID (NCBI): 84969 RRID: AB_3086330 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96NM4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924