Product Description
Size: 20ul / 150ul
The PCYOX1L (30485-1-AP) by Proteintech is a Polyclonal antibody targeting PCYOX1L in WB, ELISA applications with reactivity to Human, mouse samples
30485-1-AP targets PCYOX1L in WB, ELISA applications and shows reactivity with Human, mouse samples.
Tested Applications
Positive WB detected in: LNCaP cells, mouse cerebellum tissue
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Specification
Tested Reactivity: Human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag33077 Product name: Recombinant human PCYOX1L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 305-418 aa of BC000014 Sequence: ASFRRKQPQEAAVWRVQSPKPLFRTQLKTLFRSYYSVQTAEWQAHPLYGSRPTLPRFALHDQLFYLNALEWAASSVEVMAVAAKNVALLAYNRWYQDLDKIDQKDLMHKVKTEL Predict reactive species
Full Name: prenylcysteine oxidase 1 like
Calculated Molecular Weight: 494 aa, 55 kDa
Observed Molecular Weight: 55-57 kDa
GenBank Accession Number: BC000014
Gene Symbol: PCYOX1L
Gene ID (NCBI): 78991
RRID: AB_3086333
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8NBM8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924