Iright
BRAND / VENDOR: Proteintech

Proteintech, 30485-1-AP, PCYOX1L Polyclonal antibody

CATALOG NUMBER: 30485-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PCYOX1L (30485-1-AP) by Proteintech is a Polyclonal antibody targeting PCYOX1L in WB, ELISA applications with reactivity to Human, mouse samples 30485-1-AP targets PCYOX1L in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33077 Product name: Recombinant human PCYOX1L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 305-418 aa of BC000014 Sequence: ASFRRKQPQEAAVWRVQSPKPLFRTQLKTLFRSYYSVQTAEWQAHPLYGSRPTLPRFALHDQLFYLNALEWAASSVEVMAVAAKNVALLAYNRWYQDLDKIDQKDLMHKVKTEL Predict reactive species Full Name: prenylcysteine oxidase 1 like Calculated Molecular Weight: 494 aa, 55 kDa Observed Molecular Weight: 55-57 kDa GenBank Accession Number: BC000014 Gene Symbol: PCYOX1L Gene ID (NCBI): 78991 RRID: AB_3086333 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NBM8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924