Product Description
Size: 20ul / 150ul
The PLK3 (30486-1-AP) by Proteintech is a Polyclonal antibody targeting PLK3 in WB, IHC, IP, ELISA applications with reactivity to human samples
30486-1-AP targets PLK3 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HEK-293T cells, K-562 cells, NCI-H1299 cells, U2OS cells
Positive IP detected in: HeLa cells
Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
PLK3(Polo-like kinase 3) is also named as CNK, FNK, PRK and belongs to the protein kinase superfamily. It is involved in the regulation of DNA damage checkpoint as well as in M-phase function. Plk3 physically interacts with p53 and phosphorylates this tumor suppressor protein on serine-20, suggesting that the role of Plk3 in cell cycle progression is mediated, at least in part, through direct regulation of p53(PMID:12548019).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag33186 Product name: Recombinant human PLK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 550-646 aa of BC013899 Sequence: PSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA Predict reactive species
Full Name: polo-like kinase 3 (Drosophila)
Calculated Molecular Weight: 72 kDa
Observed Molecular Weight: 72 kDa
GenBank Accession Number: BC013899
Gene Symbol: PLK3
Gene ID (NCBI): 1263
RRID: AB_3669726
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9H4B4
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924