Iright
BRAND / VENDOR: Proteintech

Proteintech, 30486-1-AP, PLK3 Polyclonal antibody

CATALOG NUMBER: 30486-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLK3 (30486-1-AP) by Proteintech is a Polyclonal antibody targeting PLK3 in WB, IHC, IP, ELISA applications with reactivity to human samples 30486-1-AP targets PLK3 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, K-562 cells, NCI-H1299 cells, U2OS cells Positive IP detected in: HeLa cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PLK3(Polo-like kinase 3) is also named as CNK, FNK, PRK and belongs to the protein kinase superfamily. It is involved in the regulation of DNA damage checkpoint as well as in M-phase function. Plk3 physically interacts with p53 and phosphorylates this tumor suppressor protein on serine-20, suggesting that the role of Plk3 in cell cycle progression is mediated, at least in part, through direct regulation of p53(PMID:12548019). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33186 Product name: Recombinant human PLK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 550-646 aa of BC013899 Sequence: PSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA Predict reactive species Full Name: polo-like kinase 3 (Drosophila) Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: BC013899 Gene Symbol: PLK3 Gene ID (NCBI): 1263 RRID: AB_3669726 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H4B4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924