Iright
BRAND / VENDOR: Proteintech

Proteintech, 30493-1-AP, DUSP10 Polyclonal antibody

CATALOG NUMBER: 30493-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DUSP10 (30493-1-AP) by Proteintech is a Polyclonal antibody targeting DUSP10 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 30493-1-AP targets DUSP10 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse heart tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DUSP10, also known as MKP5, is a member of the MKPs subfamily involved in cell proliferation, differentiation, and migration. DUSP10 is a dual specificity phosphatase capable of dephosphorylating both pTyr and pThr residues of activated MAPKs with different affinities. It has been shown that isoforms of the p38 and JNK subfamilies are selectively and more effectively dephosphorylated than ERK subfamily members. DUSP10 has been proposed as a target for therapeutic treatment of atherosclerosis, since DUSP10 inhibition reduces NF-κB-induced TNF-α expression and increases TGF-β1 levels in this disease (PMID: 30939861). Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32718 Product name: Recombinant human DUSP10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-288 aa of BC031405 Sequence: MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLGSANPGSNSHPPVIATTVVSLKAANLTYMPSSSGSARSLNCGCSSASCCTVATYDKDNQAQTQAIAAGTTTTAIGTSTTCPANQMVNNNENTGSLSPSSGVGSPVSGTPKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSL Predict reactive species Full Name: dual specificity phosphatase 10 Observed Molecular Weight: 53 kDa GenBank Accession Number: BC031405 Gene Symbol: DUSP10 Gene ID (NCBI): 11221 RRID: AB_3086335 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6W6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924