Iright
BRAND / VENDOR: Proteintech

Proteintech, 30496-1-AP, TREM-1/CD354 Polyclonal antibody

CATALOG NUMBER: 30496-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TREM-1/CD354 (30496-1-AP) by Proteintech is a Polyclonal antibody targeting TREM-1/CD354 in WB, ELISA applications with reactivity to human samples 30496-1-AP targets TREM-1/CD354 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Triggering receptor expressed on myeloid cells 1 (TREM1, also known as CD354) is a member of the immunoglobulin superfamily, which is expressed on neutrophils and monocytes. TREM1 plays a role in the innate immune system. TREM1 amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32967 Product name: Recombinant human TREM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-205 aa of BC017773 Sequence: ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFN Predict reactive species Full Name: triggering receptor expressed on myeloid cells 1 Calculated Molecular Weight: 234 aa, 26 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC017773 Gene Symbol: TREM1 Gene ID (NCBI): 54210 RRID: AB_3086337 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NP99 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924