Iright
BRAND / VENDOR: Proteintech

Proteintech, 30504-1-AP, STIL Polyclonal antibody

CATALOG NUMBER: 30504-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STIL (30504-1-AP) by Proteintech is a Polyclonal antibody targeting STIL in WB, ELISA applications with reactivity to Human samples 30504-1-AP targets STIL in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32611 Product name: Recombinant human STIL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1118-1287 aa of BC126223 Sequence: ATKKYMKRYGLLQSSDNSEDEEEPPDNADSKSEYLLNQNLRSIPEQLGGQKEPSKNDHEIINCSNCESVGTNADTPVLRNITNEVLQTKAKQQLTEKPAFLVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSETLKQMNSMNSVGTFLDVKRLRQLPKLF Predict reactive species Full Name: SCL/TAL1 interrupting locus Calculated Molecular Weight: 1287 aa, 143 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC126223 Gene Symbol: STIL Gene ID (NCBI): 6491 RRID: AB_3669728 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15468 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924