Iright
BRAND / VENDOR: Proteintech

Proteintech, 30539-1-AP, ALAS2 Polyclonal antibody

CATALOG NUMBER: 30539-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ALAS2 (30539-1-AP) by Proteintech is a Polyclonal antibody targeting ALAS2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 30539-1-AP targets ALAS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, NIH/3T3 cells, mouse brain tissue, mouse heart tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The heme biosynthetic pathway begins from delta aminolevulinic acid synthase (ALAS) catalyzing the condensation of glycine and succinyl-CoA to delta aminolevulinic acid (ALA) in the mitochondria. ALAS is coded by two genes: ALAS1 and ALAS2 . ALAS1 is ubiquitously expressed in all cells, and the negative feedback is regulated by the heme pool; however, ALAS2 is specifically expressed only in erythroid cells. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30308 Product name: Recombinant human ALAS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 502-574 aa of BC030230 Sequence: LLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACNFCRRPVHFELMSEWERSYFGNMGPQYVTTYA Predict reactive species Full Name: aminolevulinate, delta-, synthase 2 Calculated Molecular Weight: 587 aa, 65 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC030230 Gene Symbol: ALAS2 Gene ID (NCBI): 212 RRID: AB_3086355 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22557 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924