Proteintech, 30546-1-AP, CRKL Polyclonal antibody

Size: 20ul / 150ul The CRKL (30546-1-AP) by Proteintech is a Polyclonal antibody targeting CRKL in WB, ELISA applications with reactivity to Human samples 30546-1-AP targets CRKL in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293T cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30874 Product name: Recombinant human CRKL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-242 aa of NM_005207 Sequence: LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKA Predict reactive species Full Name: v-crk sarcoma virus CT10 oncogene homolog (avian)-like Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: NM_005207 Gene Symbol: CRKL Gene ID (NCBI): 1399 RRID: AB_3086359 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P46109 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.