Iright
BRAND / VENDOR: Proteintech

Proteintech, 30550-1-AP, SLFN12 Polyclonal antibody

CATALOG NUMBER: 30550-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLFN12 (30550-1-AP) by Proteintech is a Polyclonal antibody targeting SLFN12 in WB, IHC, ELISA applications with reactivity to human samples 30550-1-AP targets SLFN12 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells, HEK-293 cells, HeLa cells, U2OS cells Positive IHC detected in: mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Schlafen family member 12 (SLFN12) is the only intermediate Schlafen protein expressed in humans (PMID: 31838790, PMID: 34571887). SLFN12 stimulates differentiation in enterocytes and prostate cancer cells, and its overexpression inhibits prostate cancer, triple-negative breast cancer (TNBC), and lung adenocarcinoma cell proliferation (PMID: 30045019, PMID: 24768141, PMID: 39594803). SLFN12 regulates human enterocytic differentiation by a pathway involving SERPB12, the deubiquitylases, and Cdx2 (PMID: 30045019). The expression of SLFN12 is increased throughout the process of T-cell activation (PMID: 28460425). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31289 Product name: Recombinant human SLFN12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 340-402 aa of BC035605 Sequence: FMVEAEPKFSSSYEEVISQINTSLPAPHSWPLLEWQRQRHHCPGLSGRITYTPENLCRKLFLQ Predict reactive species Full Name: schlafen family member 12 Calculated Molecular Weight: 578 aa, 67 kDa Observed Molecular Weight: 67-70 kDa GenBank Accession Number: BC035605 Gene Symbol: SLFN12 Gene ID (NCBI): 55106 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IYM2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924