Iright
BRAND / VENDOR: Proteintech

Proteintech, 30579-1-AP, CFAP47 Polyclonal antibody

CATALOG NUMBER: 30579-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CFAP47 (30579-1-AP) by Proteintech is a Polyclonal antibody targeting CFAP47 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30579-1-AP targets CFAP47 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MRC-5 cells, human testis tissue, mouse spermatophore tissue Positive IHC detected in: mouse testis tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CFAP47 (Cilia- and flagella-associated protein 47), formerly known as CXorf22, CXorf59, is located on the human chromosome X and highly expressed in the testis and encodes a cilia- and flagella-associated protein. CFAP47 was expressed in primary cilia of human kidney tubules, and knockout (KO) mice exhibited vacuolation of tubular cells and tubular dilation, providing evidence that CFAP47 is a causative gene involved in cyst formation (PMID: 33472045, 38633811). CFAP47-mutated male mice are sterile, with decreased sperm motility and abnormal flagella morphology (PMID: 37424856). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31679 Product name: Recombinant human CXorf59 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC101700 Sequence: MAIHLDKQNIILKNDKDEYLKKTRDGVLPPYQDAKPPSPASIKKTYTTSKFNDAEPAKGNLFIGVEVLPENLHLDESETSEEDHGSLEKEKYEQFLSLEEGTKAHYFFEKVVNAAQTWFSLFGWPEGPHSFSIPETIRRDVYKMQFYSSTSPPQKFSRQNDFSKYNKTIYDVLLHLSGKMPPGINSSQSLPVDNHEKRVIQLHLQHSSLLDFLNAQGGCISHVLPEFLLEPEDYKRWIEIMSSTNTMPVSSCTPKKKCSIVIEMSKFEAWSKRAWTDVFLQIYKVLVLSRVVPYCSNNMPPICVQNTPKVNPCFASSNIYSDSERILLSWMNINYENTRHVIWKNCHKDVI Predict reactive species Full Name: chromosome X open reading frame 59 Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC101700 Gene Symbol: CXorf59 Gene ID (NCBI): 286464 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZTR5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924