Iright
BRAND / VENDOR: Proteintech

Proteintech, 30597-1-AP, ZYG11A Polyclonal antibody

CATALOG NUMBER: 30597-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZYG11A (30597-1-AP) by Proteintech is a Polyclonal antibody targeting ZYG11A in WB, IF/ICC, ELISA applications with reactivity to human samples 30597-1-AP targets ZYG11A in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NCI-H1299 cells, HEK-293T cells, HeLa cells Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ZYG11A is a member of the Zyg11 protein family that functions as a target recruitment subunit of an E3 ubiquitin ligase complex playing a central role in the degradation of a regulatory protein involved in cell cycle regulation. ZYG11A is over-expressed in NSCLC tumor tissues and correlates with more aggressive clinical characteristics. Also ZYG11A gene constitutes a novel target for IGF1 action in endometrial cancer cells (PMID: 26771237, 31320996). This antibody is specific to isoform 2 of ZYG11A with a predicted molecular mass of 48 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30166 Product name: Recombinant human ZYG11A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 628-696 aa of NM_001004339 Sequence: TSDRQLWISRDFQRRTLLQDLHATIQNWPSSSCKMTALVTYRSFKTFFPLLGNFSQPEVQLWALWAMYH Predict reactive species Full Name: zyg-11 homolog A (C. elegans) Calculated Molecular Weight: 86 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: NM_001004339 Gene Symbol: ZYG11A Gene ID (NCBI): 440590 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6WRX3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924