Proteintech, 30613-1-AP, SOX14 Polyclonal antibody

Size: 20ul / 150ul The SOX14 (30613-1-AP) by Proteintech is a Polyclonal antibody targeting SOX14 in WB, ELISA applications with reactivity to human, mouse samples 30613-1-AP targets SOX14 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information SOX14, also known as SOX28, is a member of the SOX (SRY-related HMG-box) family of transcription factors. This intronless gene encodes a protein that acts as a transcriptional regulator after forming complexes with other proteins. It is involved in embryonic development and cell fate determination. SOX14 is primarily expressed in the nervous system, where it plays a role in neuronal differentiation and circuit formation. Mutations in SOX14 are suggested to be responsible for limb defects associated with conditions such as blepharophimosis, ptosis, epicanthus inversus syndrome (BPES), and Moebius syndrome. Additionally, SOX14 has been implicated in tumor development, with studies indicating its involvement in cervical cancer through mechanisms such as the p53 and Wnt/β-catenin pathways. (PMID: 34098886, PMID: 34181293) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31127 Product name: Recombinant human SOX14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 85-155 aa of BC106730 Sequence: NLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEV Predict reactive species Full Name: SRY (sex determining region Y)-box 14 Calculated Molecular Weight: 240 aa, 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC106730 Gene Symbol: SOX14 Gene ID (NCBI): 8403 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95416 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.