Product Description
Size: 20ul / 150ul
The MMP11 (30615-1-AP) by Proteintech is a Polyclonal antibody targeting MMP11 in WB, IF/ICC, ELISA applications with reactivity to human samples
30615-1-AP targets MMP11 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: MCF-7 cells, A549 cells, T-47D cells
Positive IF/ICC detected in: MCF-7 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
Matrix metalloproteinase 11 (MMP11), also named stromelysin-3, is a member of the stromelysin subgroup belonging to MMPs superfamily. The role of MMP11 in cancer progression has been shown by several preclinical observations: its expression promotes tumor take in mice, homing of malignant epithelial cells, cancer progression by remodeling extracellular matrix, and antiapoptotic and antinecrotic effect on tumor cells (PMID: 19509157, 26892540). The immunoblot demonstrated two separate bands of ~65 kDa (latent proenzyme form) and ~45 kD (active form) of secreted MMP-11 protein (PMID: 21442356).
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag31191 Product name: Recombinant human MMP11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 99-208 aa of NM_005940 Sequence: VLSGGRWEKTDLTYRILRFPWQLVQEQVRQTMAEALKVWSDVTPLTFTEVHEGRADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTHREGDVHFDYDETWTIGDDQGTD Predict reactive species
Full Name: matrix metallopeptidase 11 (stromelysin 3)
Calculated Molecular Weight: 55 kDa
Observed Molecular Weight: 45-55 kDa
GenBank Accession Number: NM_005940
Gene Symbol: MMP11
Gene ID (NCBI): 4320
RRID: AB_3086374
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P24347
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924