Iright
BRAND / VENDOR: Proteintech

Proteintech, 30625-1-AP, CACNA1B Polyclonal antibody

CATALOG NUMBER: 30625-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CACNA1B (30625-1-AP) by Proteintech is a Polyclonal antibody targeting CACNA1B in WB, IF-P, ELISA applications with reactivity to human, mouse samples 30625-1-AP targets CACNA1B in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells, Y79 cells Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CACNA1B, also named CACH5, CACNL1A5, and BIII, belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division, and cell death. CACNA1B gives rise to N-type calcium currents. N-type calcium channels belong to the 'high-voltage activated' (HVA) group and are blocked by omega-conotoxin-GVIA (omega-CTx-GVIA) and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to dihydropyridines (DHP), and omega-agatoxin-IVA (omega-Aga-IVA). CACNA1B may play a role in the directed migration of immature neurons. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33516 Product name: Recombinant human CACNA1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1841-1995 aa of NM_000718 Sequence: VPPHKPDEMTVGKVYAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLES Predict reactive species Full Name: calcium channel, voltage-dependent, N type, alpha 1B subunit Calculated Molecular Weight: 262 kDa Observed Molecular Weight: 200 kDa GenBank Accession Number: NM_000718 Gene Symbol: CACNA1B Gene ID (NCBI): 774 RRID: AB_3669741 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q00975 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924