Iright
BRAND / VENDOR: Proteintech

Proteintech, 30635-1-AP, AMAC1 Polyclonal antibody

CATALOG NUMBER: 30635-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AMAC1 (30635-1-AP) by Proteintech is a Polyclonal antibody targeting AMAC1 in WB, ELISA applications with reactivity to Mouse samples 30635-1-AP targets AMAC1 in WB, ELISA applications and shows reactivity with Mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information AMAC1, also known as SLC35G3. It is expected to be located in cell membrane, the protein is mainly expressed in testis. The calculated molecular weight of AMAC1 is 35 kDa. The gene encoding this protein appears to have arisen by SVA-mediated retrotransposition of the SLC35G6 gene in the primate lineage. Specification Tested Reactivity: Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30356 Product name: Recombinant human S35G3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_152462 Sequence: MAGSHPYFNQPDSTHPSPPSAPPSLRWYQRCQPSDATSGLLVALLGGGLPAGFVGPLSRMAYQASNLPSLELLIWRCLFHLPIALLLKLRGDPLLGTPDIRSRAFFCALLNILSIGCAYSAVQVVPAGNAATVRKGSSTVCSAVLTLCLE Predict reactive species Full Name: acyl-malonyl condensing enzyme 1 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 31-35 kDa GenBank Accession Number: NM_152462 Gene Symbol: AMAC1 Gene ID (NCBI): 146861 RRID: AB_3669742 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N808 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924