Product Description
Size: 20ul / 150ul
The RAB8A (30636-1-AP) by Proteintech is a Polyclonal antibody targeting RAB8A in WB, IF/ICC, ELISA applications with reactivity to human, mouse, canine samples
30636-1-AP targets RAB8A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, canine samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells, L02 cells
Positive IF/ICC detected in: NIH/3T3 cells, MDCK cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
The Rab8 GTPase is a member of the Ras superfamily that functions in protein transport and membrane restructuring. RAB8 has two isoforms, RAB8A and RAB8B, that share 40% amino acid identity in the C-terminal variable region. RAB8 activity is regulated by specific guanine nucleotide exchange factors (GEFs), that mediate GTP loading, and GTPase activating proteins (GAPs) that convert them into the inactive GDP-bound form. RAB8 participates in recycling of the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors to the dendritic spine surface as well as in the intracellular transport of the metabotropic glutamate receptor type 1 in neuronal cells. Rab8 is activated at the base of the cilium by its guanine nucleotide exchanger Rabin8. The antibody 11792-1-AP can detect both RAB8A and RAB8B.
Specification
Tested Reactivity: human, mouse, canine
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag30567 Product name: Recombinant human RAB8A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 150-204 aa of NM_005370 Sequence: TSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRC Predict reactive species
Full Name: RAB8A, member RAS oncogene family
Calculated Molecular Weight: 24 kDa
Observed Molecular Weight: 24 kDa
GenBank Accession Number: NM_005370
Gene Symbol: RAB8A
Gene ID (NCBI): 4218
RRID: AB_3086378
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P61006
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924