Iright
BRAND / VENDOR: Proteintech

Proteintech, 30639-1-AP, TMEM33 Polyclonal antibody

CATALOG NUMBER: 30639-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM33 (30639-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM33 in WB, ELISA applications with reactivity to mouse, rat samples 30639-1-AP targets TMEM33 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information TMEM33 (transmembrane protein 33), also known as DB83. It is expected to be located in endoplasmic reticulum membrane and nucleus envelope. The protein is widely expressed in prostate cancer and several cancer cell lines (at protein level). And expressed at higher levels in endocrine-resistant breast cancer cells as compared to endocrine-sensitive breast cancer cells. It is also expressed at higher levels in early recurrence breast cancer tissues as compared to non-recurrent breast tumors. The calculated molecular weight of TMEM33 is 28 kDa. It is suggest that TMEM33 has a potency to suppress the membrane-shaping activity of reticulons, thereby regulating the tubular structure of ER (PMID: 25612671). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32368 Product name: Recombinant human TMEM33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 177-247 aa of BC000948 Sequence: SGQGSLLQPFIYYRFLTLRYSSRRNPYCRTLFNELRIVVEHIIMKPACPLFVRRLCLQSIAFISRLAPTVP Predict reactive species Full Name: transmembrane protein 33 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC000948 Gene Symbol: TMEM33 Gene ID (NCBI): 55161 RRID: AB_3669743 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P57088 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924