Iright
BRAND / VENDOR: Proteintech

Proteintech, 30655-1-AP, MMP25 Polyclonal antibody

CATALOG NUMBER: 30655-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MMP25 (30655-1-AP) by Proteintech is a Polyclonal antibody targeting MMP25 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30655-1-AP targets MMP25 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HT-29 cells, Jurkat cells Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MMP25, also known as MT6-MMP, is one of the two glycosylphosphatidylinositol anchored matrix metalloproteinases (MMPs) that have been suggested to play a role in pericellular proteolysis. MMP25 was originally cloned from human leukocytes and its mRNA is predominantly expressed in leukocytes (polymorphonuclear cells and monocytes) of normal tissues and in brain, colon, urothelial and prostate cancers (PMID: 17513868). MMP-25 can exaggerate inflammatory responses by inactivating the main antiproteinase, a1-proteinase inhibitor or serpin (PMID: 16584348). The band at 57-kDa we detected is likely to be active MT6-MMP and minor MT6-MMP degradation product of 38-kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29304 Product name: Recombinant human MMP25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 260-381 aa of NM_022468 Sequence: GDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQPPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGR Predict reactive species Full Name: matrix metallopeptidase 25 Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: NM_022468 Gene Symbol: MMP25 Gene ID (NCBI): 64386 RRID: AB_3669745 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NPA2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924