Iright
BRAND / VENDOR: Proteintech

Proteintech, 30657-1-AP, PTGIR Polyclonal antibody

CATALOG NUMBER: 30657-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PTGIR (30657-1-AP) by Proteintech is a Polyclonal antibody targeting PTGIR in WB, ELISA applications with reactivity to human samples 30657-1-AP targets PTGIR in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, SGC-7901 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Prostaglandin I2 receptor (PTGIR), also known as IP, is a seven-transmembrane receptor that binds G proteins leading to activation of adenylyl cyclase and an increase in cAMP formation. PTGIR is involved in insulin secretion in pancreatic beta-cells and in permselectivity in glomerular podocytes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30653 Product name: Recombinant human PTGIR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 296-386 aa of BC075814 Sequence: RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC Predict reactive species Full Name: prostaglandin I2 (prostacyclin) receptor (IP) Calculated Molecular Weight: 386 aa, 41 kDa Observed Molecular Weight: 41-45kDa GenBank Accession Number: BC075814 Gene Symbol: PTGIR Gene ID (NCBI): 5739 RRID: AB_3669746 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43119 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924