Iright
BRAND / VENDOR: Proteintech

Proteintech, 30658-1-AP, ZBTB7A Polyclonal antibody

CATALOG NUMBER: 30658-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZBTB7A (30658-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB7A in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 30658-1-AP targets ZBTB7A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells, PC-3 cells, SGC-7901 cells, U2OS cells Positive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information ZBTB7A, also named as LRF, FBI1, FBI-1, pokemon, ZBTB7, ZNF857A and DKFZp547O146, a member of the POK (POZ and Krüppel) family of transcription factors, plays a role in differentiation, oncogenesis, and adipogenesis (PMID: 35798238). ZBTB7A is involved in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals. ZBTB7A is widely expressed in normal thymus and it is aberrantly overexpressed in human cancers (PMID: 28942243). ZBTB7A has 10 potential sumoylation sites located at lysine 61, 354, 371, 379, 383, 396, 486, 487, 536 and 539 (PMID: 20471975, 19471103). ZBTB7A has a predicted molecular weight of 61 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31077 Product name: Recombinant human ZBTB7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 459-584 aa of NM_015898 Sequence: VHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKDEDEDEDVASPDGLGRLNVAGAGGGGDSGGGPGAATDGNFTAGLA Predict reactive species Full Name: zinc finger and BTB domain containing 7A Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 61-70 kDa GenBank Accession Number: NM_015898 Gene Symbol: ZBTB7A Gene ID (NCBI): 51341 RRID: AB_3669747 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95365 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924