Proteintech, 30693-1-AP, GCNA Polyclonal antibody

Size: 20ul / 150ul The GCNA (30693-1-AP) by Proteintech is a Polyclonal antibody targeting GCNA in WB, ELISA applications with reactivity to Human samples 30693-1-AP targets GCNA in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, PC-3 cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Germ cell nuclear acidic protein (GCNA) has been extensively used as a germ cell marker for almost 30 years. Recently, mutations in GCNA have been linked to azoospermia in humans, defining GCNA as a clinical determinant of human infertility. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33720 Product name: Recombinant human ACRC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC136259 Sequence: MDGCKKELPRLQEPEEDEDCYILNVQSSSDDTSGSSVARRAPKRQASCILNVQSRSGDTSGSSVARRAPKRQASSVVVIDSDSDEECHTHEEKKAKLLEINSDDESPECCHVKPAIQEPPIVISDDDNDDDNGNDLE Predict reactive species Full Name: acidic repeat containing Calculated Molecular Weight: 691 aa, 76 kDa Observed Molecular Weight: 76 kDa GenBank Accession Number: BC136259 Gene Symbol: GCNA Gene ID (NCBI): 93953 RRID: AB_3086389 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96QF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.