Iright
BRAND / VENDOR: Proteintech

Proteintech, 30695-1-AP, GSDMD Polyclonal antibody

CATALOG NUMBER: 30695-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GSDMD (30695-1-AP) by Proteintech is a Polyclonal antibody targeting GSDMD in WB, IP, ELISA applications with reactivity to mouse samples 30695-1-AP targets GSDMD in WB, IP, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: EL-4 cells, EL-4-B5 cells, NIH/3T3 cells, mouse liver tissue Positive IP detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information GSDMD is a 53 kDa cytosolic protein and a member of the gasdermin protein family, which features 6 members in humans (GSDMA, -B, -C, -D, -E and -F. GSDMD was identified as the executioner of inflammasome-associated pyroptosis. Caspase-1, -11, or -4 cleave GSDMD after an aspartate residue within a central linker domain (D275 in humans and D276 in mice) to generate a 31-kDa N-terminal GSDMD fragment (GSDMD-NT) and a 22-kDa C-terminal fragment (GSDMD-CT). In addition to the canonical 31/22 kDa cleavage products, a 43 kDa fragment has been observed under specific experimental or pathological conditions. The generation of the 43 kDa fragment was observed upon caspase-3 and -7 activation during apoptosis. This antibody can detect 53 kDa full-length GSDMD and 43 kDa fragment as described in the literature (PMID: 28392147, PMID: 28979266). Specification Tested Reactivity: mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33609 Product name: Recombinant mouse Gsdmd protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 199-487 aa of BC029813 Sequence: GHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSDGIDEEELIEAADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQKPC* Predict reactive species Full Name: gasdermin D Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 50-53 kDa, 43 kDa GenBank Accession Number: BC029813 Gene Symbol: Gsdmd Gene ID (NCBI): 69146 RRID: AB_3086391 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9D8T2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924