Iright
BRAND / VENDOR: Proteintech

Proteintech, 30711-1-AP, SUSD2 Polyclonal antibody

CATALOG NUMBER: 30711-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SUSD2 (30711-1-AP) by Proteintech is a Polyclonal antibody targeting SUSD2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 30711-1-AP targets SUSD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SK-BR-3 cells, mouse kidney tissue, rat kidney tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Sushi domain containing 2 (SUSD2) is a type I transmembrane protein that contains a somatomedin B, AMOP, von Willebrand factor type D and Sushi domains, which are frequently found in molecules associated with cell-cell and cell-matrix adhesion. SUSD2 is composed of 822 amino acids with a predicted molecular weight of 90.4 kDa (PMID: 31387209). Three specific SUSD2 bands were present, the glycosylated, full-length protein (~110 kDa), ~90 kDa band represents full-length SUSD2 with minimal glycosylation, and a strong ~60 kDa band, represents a cleaved product of SUSD2 at the GD-PH sequence in the endoplasmic reticulum (PMID:27775699, 32595828). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33630 Product name: Recombinant human SUSD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 544-724 aa of NM_019601 Sequence: MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLCGDDHFCNFDVAATGSLSTGTATRVAHQLHQRRMQSLQPVVS* Predict reactive species Full Name: sushi domain containing 2 Calculated Molecular Weight: 90 kDa Observed Molecular Weight: 60 kDa, 90 kDa, 110 kDa GenBank Accession Number: NM_019601 Gene Symbol: SUSD2 Gene ID (NCBI): 56241 RRID: AB_3669753 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UGT4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924