Iright
BRAND / VENDOR: Proteintech

Proteintech, 30766-1-AP, EPOR Polyclonal antibody

CATALOG NUMBER: 30766-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPOR (30766-1-AP) by Proteintech is a Polyclonal antibody targeting EPOR in WB, ELISA applications with reactivity to human, mouse, rat samples 30766-1-AP targets EPOR in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, Jurkat cells, L02 cells, human placenta tissue, mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Erythropoietin (EPO) receptor (EPOR) is a glycoprotein that belongs to the type I superfamily of single-transmembrane cytokine receptors. It consists of an extracellular domain that binds to the EPO ligand, a transmembrane domain and an intracellular domain. The interaction of EPO and EPOR triggers the activation of several signaling pathways that induce erythropoiesis, including JAK2/STAT5, PI3K/AKT, and MAPK (PMID: 34281163). EPOR is present on erythroid progenitor cells and has also been detected on a wide variety of non-hematopoietic cells (PMID: 36233351). The calculated molecular weight of EPOR is 55 kDa. EPOR undergoes posttranslational modification and the apparent molecular weight of 66-78 kDa has been reported (PMID: 8943308; 12088257). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33956 Product name: Recombinant human EPOR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-250 aa of NM_000121.4 Sequence: APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP Predict reactive species Full Name: erythropoietin receptor Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_000121.4 Gene Symbol: EPOR Gene ID (NCBI): 2057 RRID: AB_3086414 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P19235 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924