Proteintech, 30790-1-AP, Cathepsin C Polyclonal antibody

Size: 20ul / 150ul The Cathepsin C (30790-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin C in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 30790-1-AP targets Cathepsin C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Cathepsin C, also known as DPP-I. It is expected to be located in lysosome and highly expressed in lung, kidney and placenta (PMID: 9092576). This gene encodes a member of the peptidase C1 family and lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in cells of the immune system. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate heavy and light chains that form a disulfide-linked dimer. Defects in the encoded protein have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis. The calculated molecular weight of Cathepsin C is 51 kDa. The 23-kDa band may be a subunit of the protein monomer, while a 100-kda band is a dimer form (PMID: 26884336, 31557781). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag32420 Product name: Recombinant human Cathepsin C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 231-463 aa of NM_001814 Sequence: LPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL Predict reactive species Full Name: cathepsin C Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: NM_001814 Gene Symbol: Cathepsin C Gene ID (NCBI): 1075 RRID: AB_3086417 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53634 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.