Proteintech, 30798-1-AP, CD300LD Polyclonal antibody

Size: 20ul / 150ul The CD300LD (30798-1-AP) by Proteintech is a Polyclonal antibody targeting CD300LD in WB, ELISA applications with reactivity to human samples 30798-1-AP targets CD300LD in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information CD300LD, also known as CD300D and CMRF35A4, is a member of the CD300 family. The CD300 family of molecules modulates a broad and diverse range of immune cell processes via their paired activating and inhibitory receptor functions. CD300LD is a 194 amino acid single-pass type I membrane protein containing an Ig-like V-type (immunoglobulin-like) domain. The apparent molecular weight is greater than the calculated molecular weight of 22 kDa, probably due to post-translational modification, presumably by glycosylation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29307 Product name: Recombinant human CD300LD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 122-194 aa of NM_001115152 Sequence: VTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTHFLFLFLLELPLLLSMLGTVLWVNRPQRRS Predict reactive species Full Name: CD300 molecule-like family member d Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 40-43 kDa GenBank Accession Number: NM_001115152 Gene Symbol: CD300LD Gene ID (NCBI): 100131439 RRID: AB_3669758 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXZ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.