Iright
BRAND / VENDOR: Proteintech

Proteintech, 30841-1-AP, MAPKAPK2 Polyclonal antibody

CATALOG NUMBER: 30841-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MAPKAPK2 (30841-1-AP) by Proteintech is a Polyclonal antibody targeting MAPKAPK2 in WB, ELISA applications with reactivity to human samples 30841-1-AP targets MAPKAPK2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, HeLa cells, Hepg2 cells, L02 cells, SW480 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information MAPKAPK2(mitogen-activated protein kinase-activated protein kinase 2) is also named as MK2, MAPKAP-K2, MK-2 and belongs to the CAMK Ser/Thr protein kinase family. MAPKAPK2, one of several kinases directly phosphorylated and activated by p38 MAPK, plays a central role in the inflammatory response and is in the nucleus of unstimulated cells and moves rapidly to the cytoplasm after stimulation(PMID:12171911). It is also involved in many other cellular processes including stress responses, nuclear export, gene expression regulation and cell proliferation. Multiple residues of MAPKAPK2 are generally phosphorylated in vivo in response to stress, but only 4 residues(Thr25, Thr222, Ser272, and Thr334) are phosphorylated by p38 MAPK in vitro(PMID:22351694). It has 2 isoforms produced by alternative splicing and the range of the molecular weight is 42-60 kDa according to the references(PMID:10666409; 11328854;8995385). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34196 Product name: Recombinant human MAPKAPK2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-120 aa of BC036060 Sequence: MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI Predict reactive species Full Name: mitogen-activated protein kinase-activated protein kinase 2 Calculated Molecular Weight: 400 aa, 46 kDa Observed Molecular Weight: 42-60 kDa GenBank Accession Number: BC036060 Gene Symbol: MAPKAPK2 Gene ID (NCBI): 9261 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P49137 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924