Iright
BRAND / VENDOR: Proteintech

Proteintech, 30847-1-AP, EGFR Polyclonal antibody

CATALOG NUMBER: 30847-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EGFR (30847-1-AP) by Proteintech is a Polyclonal antibody targeting EGFR in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 30847-1-AP targets EGFR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, mouse liver tissue Positive IHC detected in: mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The epidermal growth factor receptor (EGFR) is a member of the ErbB family of receptor tyrosine kinases (RTKs). Binding of EGFR to epidermal growth factor family ligands triggers a signaling cascade through allosteric activation of epidermal growth factor receptor kinase and trans-autophosphorylation of key tyrosine residues in the tail of the cytoplasmic receptor (PMID: 24691965). Due to phosphorylation, the apparent molecular weight is higher than the calculated molecular weight of 140 kDa. EFGR has been implicated in learning and memory enhancement and pain signaling in mammals (PMID: 20639532 and 35131940). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33621 Product name: Recombinant mouse Egfr protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 988-1210 aa of NM_207655 Sequence: RMHLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDAFLQRYSSDPTGAVTEDNIDDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLNTAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRVAPPSSEFIGA* Predict reactive species Full Name: epidermal growth factor receptor Calculated Molecular Weight: 135 kDa Observed Molecular Weight: 140-180 kDa GenBank Accession Number: NM_207655 Gene Symbol: Egfr Gene ID (NCBI): 13649 RRID: AB_3086421 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q01279 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924