Proteintech, 30863-1-AP, GPR52 Polyclonal antibody

Size: 20ul / 150ul The GPR52 (30863-1-AP) by Proteintech is a Polyclonal antibody targeting GPR52 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 30863-1-AP targets GPR52 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse small intestine tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GPR52, or G protein-coupled receptor 52, is an orphan G protein-coupled receptor (GPCR) that constitutively increases cellular cAMP levels and is coupled to the Gs protein, which activates adenylate cyclase. Agonism of GPR52 has been proposed as a therapeutic intervention for the psychotic and cognitive aspects of schizophrenia. Its role in modulating neurotransmission and the identification of ligands that can interact with it highlight its potential in therapeutic development. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31188 Product name: Recombinant human GPR52 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC067456 Sequence: MNESRWTEWRILNMSSGIVNVSERHSCPLGFGHYSVVDVCIFETVVIVLLTFLIIAGNLTVIFVF Predict reactive species Full Name: G protein-coupled receptor 52 Calculated Molecular Weight: 361 aa, 41 kDa GenBank Accession Number: BC067456 Gene Symbol: GPR52 Gene ID (NCBI): 9293 RRID: AB_3669768 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2T5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.