Iright
BRAND / VENDOR: Proteintech

Proteintech, 30864-1-AP, Glycophorin A/CD235a Polyclonal antibody

CATALOG NUMBER: 30864-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Glycophorin A/CD235a (30864-1-AP) by Proteintech is a Polyclonal antibody targeting Glycophorin A/CD235a in IHC, ELISA applications with reactivity to mouse samples 30864-1-AP targets Glycophorin A/CD235a in IHC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive IHC detected in: mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Glycophorin A (GYPA) is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). This 36 kDa protein represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33770 Product name: Recombinant mouse CD235a protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-108 aa of NM_010369 Sequence: MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVASTVGNPNQHSATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPIQHDFPALV Predict reactive species Full Name: glycophorin A Calculated Molecular Weight: 18kd GenBank Accession Number: NM_010369 Gene Symbol: Gypa Gene ID (NCBI): 14934 RRID: AB_3669769 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14220 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924