Iright
BRAND / VENDOR: Proteintech

Proteintech, 30865-1-AP, MEX3A Polyclonal antibody

CATALOG NUMBER: 30865-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MEX3A (30865-1-AP) by Proteintech is a Polyclonal antibody targeting MEX3A in WB, IF/ICC, ELISA applications with reactivity to human samples 30865-1-AP targets MEX3A in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, SH-SY5Y cells, SKOV-3 cells, HCT 116 cells Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MEX3A is a member of the MEX3 family, which widely exists in mammalian cells and encodes four different genes, MEX3A, MEX3B, MEX3C, and MEX3D. The MEX3 protein of mammals is composed of two RNA-binding KH domains and a ring domain with E3 ubiquitin ligase activity at the C terminal. The ring finger domain endows human MEX3 protein the ability to regulate ubiquitination of target proteins and then influencing their protein stability and subcellular localization.MEX3A plays complex and diverse roles in the development of various cancers. MEX3A plays a pivotal role in the post-transcriptional procession of mRNA and gene expression. MEX3A gene expression may be closely connected with malignant tumor development and progression. In most literature, MEX3A detects molecular weights between 60 and 70kDa (PMID:33159833,37845346,36354374,35490173,34976441,33159833) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33619 Product name: Recombinant human MEX3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 285-480 aa of NM_001093725 Sequence: ETHIAVRTGKILEYNNENDFLAGSPDAAIDSRYSDAWRVHQPGCKPLSTFRQNSLGCIGECGVDSGFEAPRLGEQGGDFGYGGYLFPGYGVGKQDVYYGVAETSPPLWAGQENATPTSVLFSSASSSSSSSAKARAGPPGAHRSPATSAGPELAGLPRRPPGEPLQGFSKLGGGGLRSPGGGRDCMVCFESEVTAA Predict reactive species Full Name: mex-3 homolog A (C. elegans) Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: NM_001093725 Gene Symbol: MEX3A Gene ID (NCBI): 92312 RRID: AB_3086425 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A1L020 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924