Proteintech, 30905-1-AP, PNPLA1 Polyclonal antibody

Size: 20ul / 150ul The PNPLA1 (30905-1-AP) by Proteintech is a Polyclonal antibody targeting PNPLA1 in WB, ELISA applications with reactivity to human, mouse samples 30905-1-AP targets PNPLA1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PNPLA1 is a member of the patatin-like phospholipase (PNPLA) family. PNPLAs are highly conserved enzymes of prokaryotic and eukaryotic organisms that play an important role in lipid homeostasis. PNPLA1 has been identified as an essential transacylase for acylceramide biosynthesis to maintain the epidermal permeability barrier (PMID: 30290227). It is mainly expressed in the skin and has 3 isoforms with MW of 58, 48 and 49 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34139 Product name: Recombinant human PNPLA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC103907 Sequence: MVQMMRQFLYRVLPEDSYKVTTGKLHVSLTRLTDGENVVVSEFTSKEELIEALYCSCFV Predict reactive species Full Name: patatin-like phospholipase domain containing 1 Calculated Molecular Weight: 532 aa, 58 kDa Observed Molecular Weight: 48kDa;58kDa GenBank Accession Number: BC103907 Gene Symbol: PNPLA1 Gene ID (NCBI): 285848 RRID: AB_3669778 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N8W4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.