Proteintech, 30957-1-AP, MIF Polyclonal antibody

Size: 20ul / 150ul The MIF (30957-1-AP) by Proteintech is a Polyclonal antibody targeting MIF in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to mouse, rat samples 30957-1-AP targets MIF in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: J774A.1 cells, NIH/3T3 cells, Neuro-2a cells, RAW 264.7 cells, C6 cells, mouse brain tissue, mouse kidney tissue Positive IF/ICC detected in: Neuro-2a cells, NIH/3T3 cells Positive FC (Intra) detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information MIF is a pleiotropic cytokine that contributes to the pathogenesis of many autoimmune diseases through its upstream immunoregulatory function and its polymorphic genetic locus. MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates. Specification Tested Reactivity: mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0574 Product name: Recombinant mouse MIF protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 2-115 aa of NM_010798.2 Sequence: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA Predict reactive species Full Name: macrophage migration inhibitory factor Calculated Molecular Weight: 13KD Observed Molecular Weight: 13 kDa GenBank Accession Number: NM_010798.2 Gene Symbol: Mif Gene ID (NCBI): 17319 RRID: AB_3086428 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P34884 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.