Proteintech, 30959-1-AP, TLE4 Polyclonal antibody

Size: 20ul / 150ul The TLE4 (30959-1-AP) by Proteintech is a Polyclonal antibody targeting TLE4 in WB, IP, ELISA applications with reactivity to human, mouse samples 30959-1-AP targets TLE4 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, Neuro-2 cells Positive IP detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information TLE4 (Transducin-like enhancer protein 4), also known as GRG4. It is predicted to be located in the nucleus. Tle4 promotes acquisition of corticothalamic identity and blocks emergence of core characteristics of subcerebral/corticospinal projection neuron identity, including gene expression and connectivity. During the first post-natal week, when corticothalamic innervation is ongoing, Tle4 is required to stabilize corticothalamic neuron identity, limiting interference from differentiation programs of developmentally related neuron classes (PMID: 37561632). The molecular weight of TLE4 is 76 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34006 Product name: Recombinant human TLE4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 279-408 aa of BC059405 Sequence: LDKTRLLKKDAPISPASIASSSSTPSSKSKELSLKRDMGKLSETRLSEDEQCTLGLQRWFCRLWFMNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASSLRTPMAVPCPYPTPFGI Predict reactive species Full Name: transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila) Calculated Molecular Weight: 84 kDa Observed Molecular Weight: 76-88 kDa GenBank Accession Number: BC059405 Gene Symbol: TLE4 Gene ID (NCBI): 7091 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q04727 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.