Iright
BRAND / VENDOR: Proteintech

Proteintech, 30966-1-AP, IL-1RAP Polyclonal antibody

CATALOG NUMBER: 30966-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-1RAP (30966-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1RAP in WB, IHC, ELISA applications with reactivity to human, mouse samples 30966-1-AP targets IL-1RAP in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, human placenta tissue, mouse liver tissue Positive IHC detected in: human placenta tissue, human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information IL-1RAP (Interleukin-1 receptor accessory protein), also known as IL-1RAcP, IL-1R-3, or IL-1R3, is a member of the interleukin-1 receptor family. IL-1RAP is composed of an extracellular region containing three Ig-like C2 type domains, a transmembrane region, and a cytoplasmic region with a TIR (Toll-IL-1-receptor) domain. IL-1RAP functions as a co-receptor for IL-1, IL-33, IL-36. It plays an essential role in the signaling of the IL-1 family cytokines such as IL-1, IL-33, and IL-36, as well as tyrosine kinases FLT3 and c-Kit. IL-1RAP can also exist in a soluble form. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34121 Product name: Recombinant human IL1RAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 389-570 aa of NM_001167928.1 Sequence: YRAHFGTDETILDGKEYDIYVSYARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQALLELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRRSSSDEQGLSYSSLKNV Predict reactive species Full Name: interleukin 1 receptor accessory protein Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_001167928.1 Gene Symbol: IL1RAP Gene ID (NCBI): 3556 RRID: AB_3669798 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NPH3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924