Iright
BRAND / VENDOR: Proteintech

Proteintech, 30971-1-AP, SLC6A9 / GlyT1 Polyclonal antibody

CATALOG NUMBER: 30971-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC6A9 / GlyT1 (30971-1-AP) by Proteintech is a Polyclonal antibody targeting SLC6A9 / GlyT1 in WB, ELISA applications with reactivity to human samples 30971-1-AP targets SLC6A9 / GlyT1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information SLC6A9, also named glycine transporter 1 (GlyT1), is a transporter protein of the SLC6 family of sodium- and chloride-dependent neurotransmitter transporters. GlyT1 is the main regulator of synaptic glycine concentrations, assisted by the neuronal GlyT2 (PMID: 28828604). The 55-60 kDa band is the partially glycosylated form of GlyT1 (PMID: 27874011, PMID: 8995423). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34437 Product name: Recombinant human SLC6A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 209-285 aa of NM_201649 Sequence: SSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE Predict reactive species Full Name: solute carrier family 6 (neurotransmitter transporter, glycine), member 9 Calculated Molecular Weight: 706 aa, 78 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_201649 Gene Symbol: SLC6A9 Gene ID (NCBI): 6536 RRID: AB_3669799 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48067 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924