Iright
BRAND / VENDOR: Proteintech

Proteintech, 30979-1-AP, AMAC1L2 Polyclonal antibody

CATALOG NUMBER: 30979-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AMAC1L2 (30979-1-AP) by Proteintech is a Polyclonal antibody targeting AMAC1L2 in WB, ELISA applications with reactivity to human samples 30979-1-AP targets AMAC1L2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information AMAC1L2, also known as SLC35G5, belongs to the transporter protein family 35 member G5. This protein has an N-terminal α-helix, a central β-side and a C-terminal structural domain at the cell membrane. The role of SLC35G5 in the tumor microenvironment as a drug target and also as a biomarker for diagnosis and treatment monitoring. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34353 Product name: Recombinant human AMAC1L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-36 aa of BC131696 Sequence: MAGSHPYFNLPDSTHPSPPSAPPSLRWHQRCQPSGA Predict reactive species Full Name: acyl-malonyl condensing enzyme 1-like 2 Calculated Molecular Weight: 388 aa, 35 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC131696 Gene Symbol: AMAC1L2 Gene ID (NCBI): 83650 RRID: AB_3669803 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96KT7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924