Iright
BRAND / VENDOR: Proteintech

Proteintech, 30982-1-AP, DDX60 Polyclonal antibody

CATALOG NUMBER: 30982-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DDX60 (30982-1-AP) by Proteintech is a Polyclonal antibody targeting DDX60 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 30982-1-AP targets DDX60 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, U-251 cells, U-87 MG cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human stomach tissue Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DDX60, also called FLJ20035, is an IFN-inducible gene that has been identified via a microarray analysis of genes induced by viral infection in human dendritic cells (DCs). DDX60 expression correlated strongly with immune checkpoint and immune system-related metagene clusters, and DDX60 promoted cell proliferation, migration, and invasion and was related to poor prognosis and immune resistance(PMID: 37274827). Involved in RIG-I-dependent and independent innate immune responses, DDX60 has been proven to be associated with the development of tumors. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34406 Product name: Recombinant human DDX60 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1135-1250 aa of BC038115 Sequence: KLGAVENAAESVSTFLKKKQETKRPPKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRVKFERKG Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 Calculated Molecular Weight: 1712 aa, 198 kDa Observed Molecular Weight: 170-200 kDa GenBank Accession Number: BC038115 Gene Symbol: DDX60 Gene ID (NCBI): 55601 RRID: AB_3669804 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IY21 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924