Proteintech, 30984-1-AP, BAZ2A Polyclonal antibody

Size: 20ul / 150ul The BAZ2A (30984-1-AP) by Proteintech is a Polyclonal antibody targeting BAZ2A in WB, ELISA applications with reactivity to Human, mouse samples 30984-1-AP targets BAZ2A in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, PC-3 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information BAZ2A (bromodomain adjacent to zinc finger domain 2A), also known as TIP5. It is expected to be located in nucleus, and the protein is expressed at moderate levels in most tissues analyzed, including heart, brain, placenta, lung, skeletal muscle, kidney and pancreas. BAZ2A is an epigenetic regulator affecting transcription of ribosomal RNA, it is also a regulatory subunit of the ATP-dependent NoRC-1 and NoRC-5 ISWI chromatin remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair (PubMed:28801535). The calculated molecular weight of BAZ2A is 210 kDa. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33963 Product name: Recombinant human BAZ2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-295 aa of NM_013449.4 Sequence: QYPSANPGSNLKDPPLLSQFSGGQYPLNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLELEEEQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILS Predict reactive species Full Name: bromodomain adjacent to zinc finger domain, 2A Calculated Molecular Weight: 211 kDa Observed Molecular Weight: 250-270 kDa GenBank Accession Number: NM_013449.4 Gene Symbol: BAZ2A Gene ID (NCBI): 11176 RRID: AB_3669805 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UIF9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.