Proteintech, 30988-1-AP, CST5 Polyclonal antibody

Size: 20ul / 150ul The CST5 (30988-1-AP) by Proteintech is a Polyclonal antibody targeting CST5 in WB, ELISA applications with reactivity to Human samples 30988-1-AP targets CST5 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human saliva tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CST5 (cystatin D), it is expected to be located in cytoplasmic and extracellular, and the protein is restrictively expressed at salivary gland. Human cystatin D is a novel member of the cystatin superfamily of cysteine proteinase inhibitors present in saliva and tears. The inhibitory properties displayed by cystatin D suggest that it has a function in saliva as inhibitor of either endogenous or exogenous enzymes with cathepsin S- or H-like properties (PMID: 8083219). The calculated molecular weight of CST5 is 16 kDa. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34412 Product name: Recombinant human CST5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-142 aa of BC069514 Sequence: GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV Predict reactive species Full Name: cystatin D Observed Molecular Weight: 14-16 kDa GenBank Accession Number: BC069514 Gene Symbol: CST5 Gene ID (NCBI): 1473 RRID: AB_3669808 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P28325 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.