Iright
BRAND / VENDOR: Proteintech

Proteintech, 30989-1-AP, FPR2 Polyclonal antibody

CATALOG NUMBER: 30989-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FPR2 (30989-1-AP) by Proteintech is a Polyclonal antibody targeting FPR2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 30989-1-AP targets FPR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The formyl peptide receptors (FPRs) are a group of G protein-coupled chemoattractant receptors that play important roles in host defense and inflammation (PMID: 28335409). In humans, three different isoforms are expressed (FPR1, FPR2, and FPR3). FPR2, also known as FPRL1 or ALX, is expressed by many cell types including monocytes, neutrophils, macrophages, astrocytoma cells, and epithelial cells. FPR2 conveys the biological functions of a variety of ligands, including N-formyl-methionyl peptides, the pro-resolution mediators annexin A1 (AnxA1) and lipoxin A4, as well as the activating and proinflammatory protein serum amyloid A (PMID: 22610094). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34304 Product name: Recombinant human FPR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-350 aa of BC029125 Sequence: MLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQA Predict reactive species Full Name: formyl peptide receptor 2 Calculated Molecular Weight: 351 aa, 39 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC029125 Gene Symbol: FPR2 Gene ID (NCBI): 2358 RRID: AB_3669809 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P25090 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924