Product Description
Size: 20ul / 150ul
The SLC35D1 (31019-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35D1 in WB, ELISA applications with reactivity to human, mouse, rat samples
31019-1-AP targets SLC35D1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse liver tissue, rat liver tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Background Information
SLC35D1 belongs to the TPT transporter family and is a nucleotide sugar transporter (NST) expressed in the endoplasmic reticulum. Loss-of-function mutations in SLC35D1 cause Schneckenbecken dysplasia, a severe skeletal dysplasia (PMID: 19508970; 35934917).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag34372 Product name: Recombinant human SLC35D1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 89-157 aa of BC093786 Sequence: VGKALRVVKFPDLDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGVLLKKT Predict reactive species
Full Name: solute carrier family 35 (UDP-glucuronic acid/UDP-N-acetylgalactosamine dual transporter), member D1
Calculated Molecular Weight: 355 aa, 39 kDa
Observed Molecular Weight: 35-39 kDa
GenBank Accession Number: BC093786
Gene Symbol: SLC35D1
Gene ID (NCBI): 23169
RRID: AB_3669816
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q9NTN3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924