Iright
BRAND / VENDOR: Proteintech

Proteintech, 31048-1-AP, Histone H2B Polyclonal antibody

CATALOG NUMBER: 31048-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Histone H2B (31048-1-AP) by Proteintech is a Polyclonal antibody targeting Histone H2B in WB, ELISA applications with reactivity to Human, mouse samples 31048-1-AP targets Histone H2B in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Histones are the basic nuclear proteins responsible for the nucleosome structure of the chromosomal fiber. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures.Histone H2BC1 is testis specific. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33975 Product name: Recombinant human HIST1H2BA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC066242 Sequence: MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK Predict reactive species Full Name: histone cluster 1, H2ba Observed Molecular Weight: 15 kDa GenBank Accession Number: BC066242 Gene Symbol: Histone H2B Gene ID (NCBI): 255626 RRID: AB_3669832 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96A08 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924