Iright
BRAND / VENDOR: Proteintech

Proteintech, 31063-1-AP, SMOC2 Polyclonal antibody

CATALOG NUMBER: 31063-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMOC2 (31063-1-AP) by Proteintech is a Polyclonal antibody targeting SMOC2 in WB, ELISA applications with reactivity to human, mouse samples 31063-1-AP targets SMOC2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HCT 116 cells, mouse brain tissue, mouse ovary tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Secreted modular calcium-binding protein 2 (SMOC2), which is a member of the secreted protein acidic and rich in cysteine (SPARC) family of matricellular proteins, interacts with matrix proteins, cell surface receptors, cytokines, proteasomes and other effector molecules to regulate cell-cell and cell-microenvironment communication (PMID: 36513634). It is expected to be located in extracellular space. The calculated molecular weight of SMOC2 is 50 kDa. In recent years, SMOC2 has been reported to be highly expressed in tumor tissues and to promote tumor migration, invasion and growth. In addition to its role in tumor progression, it also regulates wound healing, bone growth, fibrosis and embryogenesis (PMID: 36513634). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34966 Product name: Recombinant human SMOC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-230 aa of BC047583 Sequence: QKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRCEFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYTGYCWCVTPNGRPISGTAVAHKTPRCPGSVNEKLPQREGTGKTDDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSALEEAKQP Predict reactive species Full Name: SPARC related modular calcium binding 2 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 49-50 kDa GenBank Accession Number: BC047583 Gene Symbol: SMOC2 Gene ID (NCBI): 64094 RRID: AB_3669838 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H3U7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924