Iright
BRAND / VENDOR: Proteintech

Proteintech, 31066-1-AP, PET117 Polyclonal antibody

CATALOG NUMBER: 31066-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PET117 (31066-1-AP) by Proteintech is a Polyclonal antibody targeting PET117 in WB, IHC, ELISA applications with reactivity to human samples 31066-1-AP targets PET117 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PET117 is a chaperone protein involved in complex IV assembly that plays a role in the regulation of mitochondria-encoded cytochrome c oxidase 1 (COX1) protein synthesis in human cells (PMID: 37247699). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34525 Product name: Recombinant human PET117 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-81 aa of NX_Q6UWS5 Sequence: VHVKQQWDQQRLRDGVIRDIERQIRKKENIRLLGEQIILTEQLEAEREKMLLAKGSQKS Predict reactive species Full Name: Protein PET117 homolog, mitochondrial Calculated Molecular Weight: 81aa, 9 kDa Observed Molecular Weight: 10kDa GenBank Accession Number: NX_Q6UWS5 Gene Symbol: PET117 Gene ID (NCBI): 100303755 RRID: AB_3669839 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6UWS5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924