Iright
BRAND / VENDOR: Proteintech

Proteintech, 31069-1-AP, SLC22A10 Polyclonal antibody

CATALOG NUMBER: 31069-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC22A10 (31069-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A10 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 31069-1-AP targets SLC22A10 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, PC-12 cells, mouse kidney tissue, mouse liver tissue, rat kidney tissue, rat liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Organic anion transporter 5 (OAT5), also known as SLC22A10, belongs to the solute carrier group of membrane transport proteins that mediate cellular uptake of endogenous and exogenous organic ions (PMID: 20865662). Rare variants in SLC22A10 may be associated with Alzheimer's disease CSF profile of neuronal injury and inflammation (PMID: 35173266). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34521 Product name: Recombinant human SLC22A10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-349 aa of NM_001039752 Sequence: ESARWLIITNKLDEGLKALRKVARTNGIKNAEETLNIEVVRSTMQEELDAAQTKTTVCDLFRNPSMRKR Predict reactive species Full Name: solute carrier family 22, member 10 Calculated Molecular Weight: 541 aa, 60 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_001039752 Gene Symbol: SLC22A10 Gene ID (NCBI): 387775 RRID: AB_3669842 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q63ZE4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924