Iright
BRAND / VENDOR: Proteintech

Proteintech, 31073-1-AP, GIGYF1 Polyclonal antibody

CATALOG NUMBER: 31073-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GIGYF1 (31073-1-AP) by Proteintech is a Polyclonal antibody targeting GIGYF1 in WB, ELISA applications with reactivity to human samples 31073-1-AP targets GIGYF1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34632 Product name: Recombinant human GIGYF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 402-499 aa of BC129991 Sequence: GIQLSPGVGSSAGPPGDLEDDEGLKHLQQEAEKLVASLQDSSLEEEQFTAAMQTQGLRHSAAATALPLSHGAARKWFYKDPQGEIQGPFTTQEMAEWF Predict reactive species Full Name: GRB10 interacting GYF protein 1 Observed Molecular Weight: 140 kDa GenBank Accession Number: BC129991 Gene Symbol: GIGYF1 Gene ID (NCBI): 64599 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O75420 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924