Iright
BRAND / VENDOR: Proteintech

Proteintech, 31075-1-AP, ADAMTS14 Polyclonal antibody

CATALOG NUMBER: 31075-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADAMTS14 (31075-1-AP) by Proteintech is a Polyclonal antibody targeting ADAMTS14 in WB, ELISA applications with reactivity to human samples 31075-1-AP targets ADAMTS14 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, K-562 cells, HUVEC cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The ADAMTS (a disintegrin-like and metalloproteinase with thrombospondin motifs) is a family of extracellular metalloproteinases mediating diverse functions including matrix degradation, blood coagulation, and angiogenesis. The ADAMTS family constitutes a group of proteins composed of 19 enzymes and 7 ADAMTS-like proteins. ADAMTS14 possesses high similarity with ADAMTS2 and ADAMTS3 in sequence and domain composition (PMID: 11741898). The expression of ADAMTS14 is correlated with the occurrence and progression of colorectal cancer and oral squamous cell carcinoma (PMID: 34856162; PMID: 32102222). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34638 Product name: Recombinant human ADAMTS14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1086-1223 aa of NM_080722 Sequence: HRLCCVSCIKKASGPNPGPDPGPTSLPPFSTPGSPLPGPQDPADAAEPPGKPTGSEDHQHGRATQLPGALDTSSPGTQHPFAPETPIPGASWSISPTTPGGLPWGWTQTPTPVPEDKGQPGEDLRHPGTSLPAASPVT Predict reactive species Full Name: ADAM metallopeptidase with thrombospondin type 1 motif, 14 Calculated Molecular Weight: 134 kDa Observed Molecular Weight: 134 kDa GenBank Accession Number: NM_080722 Gene Symbol: ADAMTS14 Gene ID (NCBI): 140766 RRID: AB_3669843 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WXS8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924