Proteintech, 31083-1-AP, GOLIM4 Polyclonal antibody

Size: 20ul / 150ul The GOLIM4 (31083-1-AP) by Proteintech is a Polyclonal antibody targeting GOLIM4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 31083-1-AP targets GOLIM4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information Golgi integral membrane protein 4 (GOLIM4) is a 130-kDa membrane protein that is integrated into the cis/medial Golgi apparatus, which is a kind II Golgi protein. GOLIM4 is a Golgi protein that circulates between Golgi apparatus and endosomes, and its shuttle is pH sensitive(PMID:30068697). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34962 Product name: Recombinant human GOLIM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 350-500 aa of NM_014498 Sequence: QVGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAEDQGIQ Predict reactive species Full Name: golgi integral membrane protein 4 Calculated Molecular Weight: 82 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: NM_014498 Gene Symbol: GOLIM4 Gene ID (NCBI): 27333 RRID: AB_3669846 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O00461 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.